General Information

  • ID:  hor006982
  • Uniprot ID:  P22858
  • Protein name:  Parathyroid hormone-related protein
  • Gene name:  CXCL12; SDF1, SDF1A, SDF1B;
  • Organism:  Mus musculus
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
  • GO MF:  NA
  • GO BP:  GO:0005179 hormone activity; GO:0051428 peptide hormone receptor binding
  • GO CC:  GO:0001958 endochondral ossification; GO:0002062 chondrocyte differentiation; GO:0055074 calcium ion homeostasis; GO:0030282 bone mineralization; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007492 endoderm development; GO:0043129 surfactant homeostasis; GO:0060487 lung epithelial cell differentiation; GO:0010960 magnesium ion homeostasis; GO:0060649 mammary gland bud elongation; GO:0061182 negative regulation of chondrocyte development; GO:0032331 negative regulation of chondrocyte differentiation; GO:0060659 nipple sheath formation; GO:0002076 osteoblast development; GO:0055062 phosphate ion homeostasis; GO:0008284 positive regulation of cell population proliferation; GO:0032330 regulation of chondrocyte differentiation; GO:0010468 regulation of gene expression; GO:0001501 skeletal system development; GO:0048286 lung alveolus development; GO:0016485 protein processing

Sequence Information

  • Sequence:  VSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRREQEKKKRRTRSAWPSTAASGLLEDPLPHTSRTSLEPSLRTH
  • Length:  138
  • Propeptide:  MLRRLVQQWSVLVFLLSYSVPSRGRSVEGLGRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPAPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRREQEKKKRRTRSAWPSTAASGLLEDPLPHTSRTSLEPSLRTH
  • Signal peptide:  MLRRLVQQWSVLVFLLSYSVPSRG
  • Modification:  T2 N-acetylalanine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA